| CAS Number | 154947-66-7 |
|---|---|
| Molecular Weight | 4493.33 Da |
| Amino Acid Sequence | [LL-37, 37 aa] |
| Purity (HPLC) | ≥98% |
| Appearance | White lyophilised powder |
| Storage | Store at -20°C, protect from light |
| Solubility | Soluble in bacteriostatic water and sterile water |
| Form | Lyophilised powder |
Description
LL37 Research Peptide — Research Grade Peptide
LL37 Research Peptide is supplied as a high-purity synthetic peptide for controlled laboratory research. This material is intended for in-vitro and preclinical experimental models under appropriate institutional oversight.
Molecular Characteristics
• Sequence: synthetic peptide fragment (sequence varies by product)
• Molecular Formula: peptide-dependent (approximate)
• Molecular Weight: peptide-dependent (approximate; see COA)
• Peptide Purity: ≥98% by HPLC (batch-dependent; see COA)
• Form: Lyophilised peptide or pre-mixed solution (variant dependent)
LL37 Research Peptide is used in research settings to investigate molecular and cellular pathways relevant to ll37 research peptide-related signalling, pathway modelling, and biochemical assays. Researchers commonly employ this peptide in well-controlled studies focusing on mechanism elucidation, structure–activity relationship analysis, and pathway-specific biomarker research.
⸻
Available Formats
5 mg Lyophilised Vial
Ideal for small-scale assays, pilot studies, and experiments requiring precise micro-dosing or custom dilution parameters.
10 mg Lyophilised Vial
Suitable for extended research cycles, multi-sample studies, or laboratories requiring consistent batch integrity across multiple replicates.
10 mg / 3 ml Ready-to-Use Solution
Pre-mixed and filtered for convenience in environments requiring rapid and repeatable dispensing. Includes a precision micro-dispensing applicator designed to deliver accurate volumes for fine-scale experimental setups.
⸻
Applications in Research
Common uses include:
• Mechanistic pathway analysis
• Cellular signalling assays
• Biochemical and in-vitro model systems
• Preclinical pathway validation studies
⸻
Storage & Handling
• Store lyophilised peptide at −20°C or below
• Once reconstituted, keep at 2–8°C and use within recommended stability window
• Avoid repeated freeze–thaw cycles
• Handle under sterile laboratory conditions
⸻
Research-Use Only
This product is supplied strictly for laboratory research use. Not for human consumption, medical use, diagnostic procedures, or veterinary applications.
CoA Available on Request
The Certificate of Analysis for this product is available upon request. Please contact us at coa@amino-research.co.uk with the product name and batch number.
Storage Temperature
Store at -20°C, protect from light
Handling Precautions
Handle with appropriate laboratory PPE including gloves and safety glasses. Avoid repeated freeze-thaw cycles. Allow vial to reach room temperature before opening.
Shelf Life
Lyophilised: 24 months from date of manufacture when stored at -20°C. Reconstituted: 30 days when stored at 2-8°C. Check CoA for specific batch expiry dates.
Only logged in customers who have purchased this product may leave a review.

Reviews
There are no reviews yet.